Loading...
Statistics
Advertisement

Asociación Española de Ayuda Mutua contra Fobia Social y Trastornos ...
www.amtaes-asociacion.com/
La Asociación Española de Ayuda Mutua contra Fobia Social y Trastornos de Ansiedad – AMTAES está constituida por afectados, familiares y allegados ...

Amtaes-asociacion.com

Advertisement
Amtaes-asociacion.com is hosted in United States / San Francisco . Amtaes-asociacion.com uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Gravatar, Html, Number of used javascripts: 5. First javascripts: Gprofiles.js, Wpgroho.js, Jquery.autoresize.js, Number of used analytics tools: 1. First analytics tools: ComScore, Its server type is: nginx. Its CMS is: Wordpress.

Technologies in use by Amtaes-asociacion.com

Technology

Number of occurences: 8
  • CSS
  • Gravatar
  • Html
  • Html5
  • Iframe
  • Javascript
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 5
  • gprofiles.js
  • wpgroho.js
  • jquery.autoresize.js
  • script.js
  • w.js

Content Management System

Number of occurences: 1
  • Wordpress

Analytics

Number of occurences: 1
  • comScore

Server Type

  • nginx

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Amtaes-asociacion.com

SSL certificate

    • name: /CN=tls.automattic.com
    • subject:
      • CN: tls.automattic.com
    • hash: 6338c477
    • issuer:
      • C: US
      • O: Let's Encrypt
      • CN: Let's Encrypt Authority X3
    • version: 2
    • serialNumber: 305824697402169823231304834028145237636840
    • validFrom: 160404105900Z
    • validTo: 160703105900Z
    • validFrom_time_t: 1459767540
    • validTo_time_t: 1467543540
    • extensions:
      • keyUsage: Digital Signature, Key Encipherment
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • basicConstraints: CA:FALSE
      • subjectKeyIdentifier: 87:31:32:E9:5B:BB:9F:C8:1F:62:6D:1C:ED:86:04:10:53:63:F0:5B
      • authorityKeyIdentifier: keyid:A8:4A:6A:63:04:7D:DD:BA:E6:D1:39:B7:A6:45:65:EF:F3:A8:EC:A1
      • authorityInfoAccess: OCSP - URI:http://ocsp.int-x3.letsencrypt.org/ CA Issuers - URI:http://cert.int-x3.letsencrypt.org/
      • subjectAltName: DNS:amsterdampornguide.com, DNS:amsterdamprivateboattour.com, DNS:amsterdamrxp.com, DNS:amsterdamsel.com, DNS:amsterdamspurs.com, DNS:amsterdamwhitneygallery.com, DNS:amsterdogblog.com, DNS:amsthinktank.com, DNS:amstohr.com, DNS:amsuganda.org, DNS:amtaes-asociacion.com, DNS:amtales.com, DNS:amtastudentblog.com, DNS:amtaxidermy.com, DNS:amtayouradvantage.com, DNS:amtbvancouver.com, DNS:amtea.net, DNS:amtextilesolutions.com, DNS:amtfdizi.com, DNS:amtgala.com, DNS:amth.org, DNS:amthirdpartyreport.com, DNS:amthompson.net, DNS:amtice.com, DNS:amtlecolemusique.com, DNS:amtlive.org, DNS:amtlpaul.com, DNS:amtonberg.com, DNS:amtphotographynyc.com, DNS:amtrakcareersnewsletter.com, DNS:amtrakmarketfridaysweepstakes.com, DNS:amtraknews.com, DNS:amtraveltimes.com, DNS:amtup.net, DNS:amtuusimaa.net, DNS:amtzweinull.com, DNS:amuciq.org, DNS:amuddylife.com, DNS:amuddymess.com, DNS:amughalffull.com, DNS:amulet-project.org, DNS:amulethunter.com, DNS:amuletsbymerlin.me, DNS:amuletstrange.com, DNS:amulmago.com, DNS:amulyabodden.com, DNS:amulyadatla.com, DNS:amulyagopalakrishnan.com, DNS:amumandotherthings.com, DNS:amumediation.com, DNS:tls.automattic.com
      • certificatePolicies: Policy: 2.23.140.1.2.1 Policy: 1.3.6.1.4.1.44947.1.1.1 CPS: http://cps.letsencrypt.org User Notice: Explicit Text: This Certificate may only be relied upon by Relying Parties and only in accordance with the Certificate Policy found at https://letsencrypt.org/repository/

Meta - Amtaes-asociacion.com

Number of occurences: 12
  • Name:
    Content: https://www.facebook.com/WordPresscom
  • Name: generator
    Content: WordPress.com
  • Name: twitter:site
    Content: @enrike45
  • Name: twitter:image
    Content: https://secure.gravatar.com/blavatar/6d9d41f40cfc215a0fb7784aacb2a587?s=240
  • Name: twitter:card
    Content: summary
  • Name: twitter:creator
    Content: @enrike45
  • Name: application-name
    Content: Asociación Española de Ayuda Mutua contra Fobia Social y Trastornos de Ansiedad
  • Name: msapplication-window
    Content: width=device-width;height=device-height
  • Name: msapplication-tooltip
    Content: Sitio web de la Asociación sin ánimo de lucro AMTAES
  • Name: msapplication-task
    Content: name=Foros de WordPress.com;action-uri=http://forums.wordpress.com/;icon-uri=https://s2.wp.com/i/favicon.ico
  • Name: title
    Content: Bienvenido a AMTAES | Asociación Española de Ayuda Mutua contra Fobia Social y Trastornos de Ansiedad en WordPress.com
  • Name: description
    Content: La Asociación Española de Ayuda Mutua contra Fobia Social y Trastornos de Ansiedad – AMTAES está constituida por afectados, familiares y allegados que se comprometen a prestarse apoyo mutuo, tanto de forma virtual por Internet, como a través de encuentros presenciales de los Grupos de Ayuda Mutua (GAM) que se están formando en diferentes ciudades de España.…

Server / Hosting

  • IP: 192.0.78.24
  • Latitude: 37.75
  • Longitude: -122.42
  • Country: United States
  • City: San Francisco

Rname

  • ns2.wordpress.com
  • ns3.wordpress.com
  • ns1.wordpress.com
  • smtp-fwd.wordpress.com

Target

  • hostmaster.wordpress.com

HTTP Header Response

HTTP/1.1 301 Moved Permanently Server: nginx Date: Sat, 07 May 2016 06:14:26 GMT Content-Type: text/html Content-Length: 178 Location: https://amtaes-asociacion.com/ X-ac: 3.fra _dca X-Cache: MISS from s_xt13 X-Cache-Lookup: MISS from s_xt13:80 Via: 1.1 s_xt13 (squid/3.5.13) Connection: keep-alive HTTP/1.1 200 Connection established HTTP/1.1 200 OK Server: nginx Date: Sat, 07 May 2016 06:14:27 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive Strict-Transport-Security: max-age=86400 Vary: Accept-Encoding Vary: Cookie X-hacker: If you're reading this, you should visit automattic.com/jobs and apply to join the fun, mention this header. X-Pingback: https://amtaes-asociacion.com/xmlrpc.php Link: ; rel=shortlink X-ac: 3.fra _dca

DNS

host: amtaes-asociacion.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.25
host: amtaes-asociacion.com
  1. class: IN
  2. ttl: 300
  3. type: A
  4. ip: 192.0.78.24
host: amtaes-asociacion.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.wordpress.com
host: amtaes-asociacion.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.wordpress.com
host: amtaes-asociacion.com
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.wordpress.com
host: amtaes-asociacion.com
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.wordpress.com
  5. rname: hostmaster.wordpress.com
  6. serial: 2005071858
  7. refresh: 14400
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 300
host: amtaes-asociacion.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 10
  5. target: smtp-fwd.wordpress.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.mtaes-asociacion.com, www.aomtaes-asociacion.com, www.omtaes-asociacion.com, www.apmtaes-asociacion.com, www.pmtaes-asociacion.com, www.a9mtaes-asociacion.com, www.9mtaes-asociacion.com, www.amtaes-asociacion.com, www.mtaes-asociacion.com, www.aimtaes-asociacion.com, www.imtaes-asociacion.com, www.aumtaes-asociacion.com, www.umtaes-asociacion.com, www.ataes-asociacion.com, www.amptaes-asociacion.com, www.aptaes-asociacion.com, www.amotaes-asociacion.com, www.aotaes-asociacion.com, www.amitaes-asociacion.com, www.aitaes-asociacion.com, www.amktaes-asociacion.com, www.aktaes-asociacion.com, www.am.taes-asociacion.com, www.a.taes-asociacion.com, www.amutaes-asociacion.com, www.autaes-asociacion.com, www.amjtaes-asociacion.com, www.ajtaes-asociacion.com, www.amntaes-asociacion.com, www.antaes-asociacion.com, www.am-taes-asociacion.com, www.a-taes-asociacion.com, www.amaes-asociacion.com, www.amtqaes-asociacion.com, www.amqaes-asociacion.com, www.amtaaes-asociacion.com, www.amaaes-asociacion.com, www.amt aes-asociacion.com, www.am aes-asociacion.com, www.amtwaes-asociacion.com, www.amwaes-asociacion.com, www.amteaes-asociacion.com, www.ameaes-asociacion.com, www.amtzaes-asociacion.com, www.amzaes-asociacion.com, www.amtxaes-asociacion.com, www.amxaes-asociacion.com, www.amtcaes-asociacion.com, www.amcaes-asociacion.com, www.amtes-asociacion.com, www.amtaoes-asociacion.com, www.amtoes-asociacion.com, www.amtapes-asociacion.com, www.amtpes-asociacion.com, www.amta9es-asociacion.com, www.amt9es-asociacion.com, www.amtaes-asociacion.com, www.amtes-asociacion.com, www.amtaies-asociacion.com, www.amties-asociacion.com, www.amtaues-asociacion.com, www.amtues-asociacion.com, www.amtas-asociacion.com, www.amtaexs-asociacion.com, www.amtaxs-asociacion.com, www.amtaess-asociacion.com, www.amtass-asociacion.com, www.amtaews-asociacion.com, www.amtaws-asociacion.com, www.amtaers-asociacion.com, www.amtars-asociacion.com, www.amtaefs-asociacion.com, www.amtafs-asociacion.com, www.amtaevs-asociacion.com, www.amtavs-asociacion.com, www.amtaecs-asociacion.com, www.amtacs-asociacion.com, www.amtaeqs-asociacion.com, www.amtaqs-asociacion.com, www.amtaeas-asociacion.com, www.amtaas-asociacion.com, www.amtaeys-asociacion.com, www.amtays-asociacion.com, www.amtae-asociacion.com, www.amtaese-asociacion.com, www.amtaee-asociacion.com, www.amtaesw-asociacion.com, www.amtaew-asociacion.com, www.amtaesd-asociacion.com, www.amtaed-asociacion.com, www.amtaesx-asociacion.com, www.amtaex-asociacion.com, www.amtaesf-asociacion.com, www.amtaef-asociacion.com, www.amtaesg-asociacion.com, www.amtaeg-asociacion.com, www.amtaest-asociacion.com, www.amtaet-asociacion.com, www.amtaesasociacion.com, www.amtaes-tasociacion.com, www.amtaestasociacion.com, www.amtaes-gasociacion.com, www.amtaesgasociacion.com, www.amtaes-hasociacion.com, www.amtaeshasociacion.com, www.amtaes-uasociacion.com, www.amtaesuasociacion.com, www.amtaes-jasociacion.com, www.amtaesjasociacion.com, www.amtaes-xasociacion.com, www.amtaesxasociacion.com, www.amtaes-sasociacion.com, www.amtaessasociacion.com, www.amtaes-aasociacion.com, www.amtaesaasociacion.com, www.amtaes-asociacion.com, www.amtaesasociacion.com, www.amtaes- asociacion.com, www.amtaes asociacion.com, www.amtaes-sociacion.com, www.amtaes-aosociacion.com, www.amtaes-osociacion.com, www.amtaes-apsociacion.com, www.amtaes-psociacion.com, www.amtaes-a9sociacion.com, www.amtaes-9sociacion.com, www.amtaes-asociacion.com, www.amtaes-sociacion.com, www.amtaes-aisociacion.com, www.amtaes-isociacion.com, www.amtaes-ausociacion.com, www.amtaes-usociacion.com, www.amtaes-aociacion.com, www.amtaes-aseociacion.com, www.amtaes-aeociacion.com, www.amtaes-aswociacion.com, www.amtaes-awociacion.com, www.amtaes-asdociacion.com, www.amtaes-adociacion.com, www.amtaes-asxociacion.com, www.amtaes-axociacion.com, www.amtaes-asfociacion.com, www.amtaes-afociacion.com, www.amtaes-asgociacion.com, www.amtaes-agociacion.com, www.amtaes-astociacion.com, www.amtaes-atociacion.com, www.amtaes-asciacion.com, www.amtaes-asobciacion.com, www.amtaes-asbciacion.com, www.amtaes-asohciacion.com, www.amtaes-ashciacion.com, www.amtaes-asogciacion.com, www.amtaes-asgciacion.com, www.amtaes-asojciacion.com, www.amtaes-asjciacion.com, www.amtaes-asomciacion.com, www.amtaes-asmciacion.com, www.amtaes-aso ciacion.com, www.amtaes-as ciacion.com, www.amtaes-asovciacion.com, www.amtaes-asvciacion.com,

Other websites we recently analyzed

  1. Avenue Welding & Support Services
    Specializing in outfitting marine vessels, Avenue Welding & Support Services in Ventura, California, provides quality builds, repairs, and creations. We even offer mobile welding services.
    Jacksonville (United States) - 209.237.150.20
    Server software: Apache
    Technology: CSS, Javascript, Php
    Number of Javascript: 8
    Number of meta tags: 4
  2. www.portalongs.com is parked at myhosting.com!
    Affordable website & domain hosting services for businesses of all sizes. Click here or call 1-866-289-5091 to get your website online today!
    Toronto (Canada) - 168.144.1.36
    Server software: Microsoft-IIS/8.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 2
    Number of meta tags: 2
  3. Studio Wesdorp, Packaging & Design - Vormgeving & Design
    StudioWesdorp, wat wij doen: Wij geven uw Visual Identity vorm. Verzorgen drukwerk, schieten bedrijfsfilms, bouwen Apps, renderen 3D visualisaties.
    Netherlands - 77.74.54.129
    Server software: Apache/2
    Technology: CSS, Html, Javascript, jQuery, Drupal
    Number of Javascript: 7
    Number of meta tags: 5
  4. resvalanalytics.com
    Dallas (United States) - 50.23.218.100
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  5. Dakik Teslimat
    Dakik Teslimat
    Turkey - 178.210.175.26
    G Analytics ID: UA-77201819-1
    Server software: Apache
    Technology: CSS, Html, Html5, Google Analytics
    Number of Javascript: 2
    Number of meta tags: 5
  6. Vantage Homes | Premier Home Builder Hot Springs Village
    Amsterdam (Netherlands) - 181.224.153.156
    Server software: nginx
    Technology: BootstrapCDN, Maxcdn, CSS, Font Awesome, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
    Number of Javascript: 8
    Number of meta tags: 6
  7. Vua hạt giống | Siêu thị hạt giống hoa Toàn Quốc
    Đại lý chuyên cung cấp bán hạt giống hoa chất lượng nhất Việt Nam với giá thành rẻ nhất. Mua hạt giống tại địa chỉ 0997007668
    Vietnam - 112.78.4.141
    Server software: Apache
    Technology: CSS, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Histats, Wordpress, Facebook Box
    Number of Javascript: 16
    Number of meta tags: 4
  8. madtieday.org
    United Kingdom - 81.21.76.62
    Server software: Apache/2.2.3 (CentOS)
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 1
    Number of meta tags: 1
  9. thedeclarationmadeeasy.info
    Scottsdale (United States) - 50.63.202.40
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  10. Home - Madly In Love With Me
    Chicago (United States) - 181.224.147.210
    Server software: nginx/1.4.6 (Ubuntu)
    Technology: CloudFront, CSS, Google Font API, Html, Html5, Javascript, jQuery, PageSpeed Module, Php, Pingback, Google Analytics, Wordpress
    Number of Javascript: 7
    Number of meta tags: 8

Check Other Websites